All smallwares and dishes must be removed from the prep area before food preparation begins:
To reduce risk of physical contaminants.To ensure correct portioning.To decrease food wasteWhat is a foodborne illness?A foodborne illness is a type of disease that's generally caused due to the consumption of a contaminated food or any food material that has been poisoned.
According to the Food and Drugs Administration (FDA), all smallwares and dishes must be removed from the prep area before food preparation begins:
To reduce risk of physical contaminants.To ensure correct portioning.To decrease food wasteRead more on food poisoning here: https://brainly.com/question/27128518
#SPJ1
Complete Question:
Why must all smallwares and dishes be removed from the prep area before food preparation begins? (Select all that apply)
To reduce risk of physical contaminants
To create a penitary environment
To ensure correct portioning
To decrease food waste
i
n the passage, Dan is characterized as someone who is
Choose 1 answer:
honest.
foolish.
stubborn.
distrustful.
if you had real dad that was not in your life would you write him a letter yes or no and explain your answer please
When talking to your parents, it's best to get straight to the point. Say something like "Hey, I wanted to ask you guys about something." Then, calmly and maturely introduce the subject.
The authors imply that the response of various officials to attempts to measure their countries’ carbon stock through field surveys has been Choose 1 answer: unhelpful, because they fear that jobs for their countries’ scientists will be lost. Helpful, because their countries have invested significantly in technology to allow studies to expand. Helpful, because their countries stand to benefit from universal carbon data that the studies will uncover. Unhelpful, because they do not make their countries’ land holdings readily available for study. Ing LiDAR, as opposed to fieldwork, for measuring carbon in tropical forests is the Choose 1 answer: scale and rapidity with which LiDAR can be used. Expense of hiring scientists to carry out fieldwork. Rapid changes and improvements in LiDAR technology. Precision of LiDAR, which eliminates human error
Answer: because they do not make their countries' landholdings readily available for study.
The scientific method is a process used by scientists to solve problems that can be tested. Describe how a scientist can create a good hypothesis for her experiment. Include where the information comes from, what a hypothesis is, and how it should be written.
Answer:
هذه معادلة قوية جدا وبسيطة
Explanation:
هذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطةهذه معادلة قوية جدا وبسيطة
Salt dissolved in water is an example of a mixture, because it can be separated by evaporation. true or false
Dan's motorcycle tank holds 6 1/2 gallons of gas. There are 3 5/8 gallons of gas currently in the tank. How much more
gasoline will it take to fill the tank? (Simplify your answer and write it as a mixed number.)
Answer:
2 7/8
Explanation:
You have to subtract the two numbers to find how much more gas you need to fill the tank.
First, subtract the 6 and 3, getting 3. You then have to subtract the 1/2 and 5/8, meaning the denominators have to be the same to be able to subtract them. So you make the 1/2 to 4/8 by multiplying 4/4 to the numerator and the denominator. You keep the 5/8 because now both fractions have the same denominator. So then you subtract 4/8 and 5/8 which is -1/8.
But we still have the 3, which you can take the -1/8 from, getting 2 and 7/8 because 8/8 is the same as a whole.
Hope this was helpful and let me know if it could be clearer!
The amount of gasoline will it take to fill the tank is 2 7/8.
What is gasoline?Gasoline is defined as a supplementary fuel that is high in energy and can be used as a form of cash. Many different compounds that include hydrogen and carbon are combined to make gasoline. A typical gasoline mixture typically contains about 150 different hydrocarbons, including butane, pentane, isopentane, and the BTEX compounds.
First, subtract the 6 from the 3 to arrive at 3. The 1/2 and 5/8 must then be subtracted, so the denominators must match for this to be possible. Therefore, you multiply 4/4 by the numerator and denominator to create the 1/2 to 4/8. Since both fractions now have the same denominator, you preserve the 5/8. So you take out 4/8 and 5/8 to get -1/8. However, the 3 remains, from which you can subtract 1/8 to get 2 and 7/8 because 8/8 is a whole that is the same.
Thus, the amount of gasoline will it take to fill the tank is 2 7/8.
To learn more about gasoline, refer to the link below:
https://brainly.com/question/28762820
# SPJ2
What is the viable to 2799?
Observations made by the House Committee on Finance, Technology, Energy, & Communications. Title: A Solar Hot Water System Tax Exemption Act.
What is technology's plain definition?
Technology, or as it is sometimes referred to, the alteration and manipulation of the human environment, is the application of scientific knowledge to the practical goals of human life. Another way to look at technology is to use engineering, applied science, and pure science to explore the development, application, and interaction of technical means with society and the environment. the entire amount of ways that social groups obtain the valuable possessions for their cultures.
Know more about Communications visit;
https://brainly.com/question/22558440
#SPJ1
What type of goal typically takes a couple of years or longer to complete?
A. An intermediate goal
B. An instant goal
C. A short-term goal
D. A long-term goal
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
fix the pronoun error
1. When I looked up at the stars, I couldn't believe it was so many light-years away
bolded words-it was
Answer:
There were
Explanation:
When I looked up the stars, I couldn't believe it was so many light-years away
When I looked up the stars, I couldn't believe there were so many light-years away
Past tense
the graph shows the ratio of (Federal) Debt to GDP (gray bars indicate a recession)
Based on the graph, explain how the country's rate of GDP growth has compared to its debt growth over time and what the implication is for the debt/gdp ratio.
(Answer must be 200 words max)
The growth rate of GDP determines a direct relation between debt growth over time and this relation reveals that a 1% point increase in the ratio of government debt to GDP would reduce real GDP growth by about 0.01 percentage point.
What is the Debt-to-GDP ratio?The debt-to-GDP ratio is the metric comparing a country's public debt to its gross domestic product (GDP). By comparing what a country owes with what it produces, the debt-to-GDP ratio reliably indicates that particular country's ability to pay back its debts.
According to the context of this question, a 1% point increase in the ratio of government consumption to GDP leads to a decline in the real economic growth of about 0.1 percentage points, on average. This ratio is useful for investors, leaders, and economists. It allows them to gauge a country's ability to pay off its debt.
To learn more about Debt-to-GDP ratio, refer to the link:
https://brainly.com/question/22595258
#SPJ1
Based on the clues in the excerpt, what does gotcha mean?have caught youhave admired youhave released youhave despised you
Based on the clues in the excerpt, gotcha mean have caught you.
What is excerpt?A short story or a scene from a film, broadcast, or piece of music or composing.
The word gotcha means I have got you or caught you.
It is used to express satisfaction at having captured or defeated someone or uncovered their falsehood.
Thus, Based on the clues in the excerpt, gotcha mean have caught you.
Learn more about excerpt.
https://brainly.com/question/16376024
#SPJ2
for g(x)= x^2 -5x+8 find the average rate of change on interval [1,6]
The average rate of change on interval [1, 6] is equal to 2.
What is an average rate of change?An average rate of change is also referred to as slope and it can be defined as a type of function that describes the average rate at which a quantity changes (decreases or increases) with respect to another quantity, over a period of time (interval).
In Mathematics, the average rate of change of f(x) on a closed interval [a, b] is given by:
Average rate of change = [f(b) - f(a)]/(b - a)
For f(a), we have:
f(a) = f(1) = 1² - 5(1) + 8
f(1) = 1 - 5 + 8
f(1) = 4
For f(b), we have:
f(b) = f(6) = 6² - 5(6) + 8
f(6) = 36 - 30 + 8
f(6) = 14
Substituting the parameters into the formula, we have;
Average rate of change = [f(b) - f(a)]/(b - a)
Average rate of change = [14 - 4]/(6 - 1)
Average rate of change = 10/5
Average rate of change = 2
Read more on Average rate of change here: https://brainly.com/question/24313700
#SPJ1
Which sentence has an error?
Responses
A At the beach with her two sisters, John's mother wasn't sure whether those flip-flops were hers' or one of theirs.At the beach with her two sisters, John's mother wasn't sure whether those flip-flops were hers' or one of theirs.
B Some of the other students turned in essays half-done, but mine had already been through two drafts and strong edits.Some of the other students turned in essays half-done, but mine had already been through two drafts and strong edits.
C Whose name is written on these checks that were given to our cashier at lunch today?Whose name is written on these checks that were given to our cashier at lunch today?
D Do not underestimate your ability to learn a new skill, no matter what age you may be.
A sentence which has an error is: A. At the beach with her two sisters, John's mother wasn't sure whether those flip-flops were hers' or one of theirs.
What is a sentence?In English literature, a sentence can be defined as a group of words or phrases that comprises a subject and predicate, which are typically used by a writer or speaker to convey a logical information about a subject matter to an audience (readers or listeners).
What are the types of pronoun?In English language, there are seven (7) main types of pronouns and these include the following:
Relative pronounsReflexive pronounsIndefinite pronounsPersonal pronounsDemonstrative pronounsInterrogative pronounsIntensive pronounsPossessive pronounsGenerally speaking, the possessive pronoun "hers" cannot personalized by adding the letter "s" with an apostrophe as demonstrated by the author in answer option A (hers').
Read more on sentence here: brainly.com/question/17467174
#SPJ1
Whats some random things that make people happy :'(
Answer:
love, love makes people happy
Answer:
1. When you’re reading a book and you get to the middle, and then a little past the middle, and suddenly the book feels fatter on the left and you feel satisfied and excited at the same time
2. Pouring milk in your coffee and seeing the swirl of white and black, like clouds drifting across the surface, pulling apart and crashing together
3. Taking your shoes off after a long day.
4. Saying “Have a nice day” to a stranger and exchanging a genuine smile that reminds you how kind people can be.
5. Talking to your best friend on the phone at 2 a.m. about deep subjects you can’t talk to anyone else about.
6. Waking up before dawn and hearing the stillness of a world that hasn’t revved up yet.
7. Getting a phone call from a friend you thought you lost and realizing the person is still there for you.
8. Receiving encouragement and approval from your picky boss or teacher.
9. Seeing a couple on the street holding hands and smiling.
10. Hot coffee or tea and a warm, snuggly blanket.
11. That rush of excitement and comfort when you’ve made a new close friend.
12. A Saturday with absolutely nothing to do except curl up with your significant other (or a significant pet).
13. The way your dog comes to greet you so enthusiastically whenever you come home
14. Fresh, crisp sheets that smell like fabric softener.
15. Wandering around a museum when it’s fairly empty and absorbing the beauty surrounding you.
16. Finding a really awesome band, listening to them nonstop, and getting all the lyrics right for the first time.
17. Recognizing Orion in the night sky
18. Running into your favorite middle or high school teacher and catching up with them as an adult, and having them be proud of you
19. Calling your mom to vent to her, and getting the feeling that you’re 13 again and she completely has your back
20. Locking eyes with a cute stranger and feeling flushed
21. Walking in a new pair of deeply comfortable shoes for the first time
22. When spring comes and in the morning you can hear birds chirping for the first time in months
23. Pie ;)
If f (x) = -2x^2 – 3x + 1, what is the value of |f (1)|?
A) 3
B) 4
C) 5
D) 6
Answer: B) 4
Explanation:
Given: f(x)=2x^2-3x-1
Then, f(1)=2(1)^2-3(1)-1
f(1)=2^4-4
f(1)=8-4
f(1)=4
4. The purpose of an experiment is to gather data to determine if the
supported or not supported.
Answer: Supported
Explanation: In an experiment related to a hypothesis (often in the form of an if/then statement), the results aiming to support or contradict a theory.
The purpose of an experiment is to gather data to determine if the results support or contradict the theory.
What is the purpose of an experiment?When undertaking research, scientists use the clinical technique to accumulate measurable, empirical proof in a test associated with a hypothesis (regularly withinside the shape of an if/then statement) this is designed to aid or contradict a systematic theory.
Thus, the correct statement will be supported.
Learn more about experiment here:
https://brainly.com/question/17274244
#SPJ2
Which of these is most likely an invertebrate? A mushrooms, which are fungi but are often mistaken for plants B oak trees, which belong to the plant kingdom and produce acorns C chimpanzees, which belong to the animal kingdom and related to humans D comb jellies, which belong to the animal kingdom and share many characteristics with jellyfish
Answer:mushroom
Explanation:i alredy did the qustion before
If a committee has 7 members? Find the probability of having more female members than the male members given that the probability of having a male or female member is equal
Answer:
Let's assume that the probability of having a male or female member is 0.5 or 50%.
There are different ways to approach this problem, but one possible method is to use the binomial distribution.
First, let's calculate the probability of having exactly 3 females, which is the midpoint between 0 and 7 females.
P(3 females) = (7 choose 3) * 0.5^7 = 0.2734
This means that there is a 27.34% chance of having exactly 3 females in the committee.
Next, let's calculate the probability of having 4, 5, 6, or 7 females, which would satisfy the condition of having more females than males.
P(4 or more females) = P(4 females) + P(5 females) + P(6 females) + P(7 females)
P(4 females) = (7 choose 4) * 0.5^7 = 0.2734
P(5 females) = (7 choose 5) * 0.5^7 = 0.1641
P(6 females) = (7 choose 6) * 0.5^7 = 0.0547
P(7 females) = (7 choose 7) * 0.5^7 = 0.0078
Therefore,
P(4 or more females) = 0.2734 + 0.1641 + 0.0547 + 0.0078 = 0.5
This means that there is a 50% chance of having more females than males in the committee, given that the probability of having a male or female member is equal.
The ratio of x to y is 2 to 3. If the sum of x and y is 125, what is the value of x?
Answer:
Given, the ratio of the two numbers = 3 : 2
Let’s assume that the two numbers are 3x and 2x (where, x is not equal to zero).
3x + 2x = 75
-> 5x = 75
-> x =15
Explanation:
Write a formula what does begin with?
Answer:the beginning of a formula is a = sign
Explanation: hoped that helped and do great on your SAT
8.What causes an Aurora?
Answer:
When charged particles from the sun strike atoms in Earth's atmosphere, they cause electrons in the atoms to move to a higher-energy state. When the electrons drop back to a lower energy state, they release a photon: light. This process creates the beautiful aurora, or northern lights.
Answer:
When charged particles from the sun strike atoms in Earth's atmosphere, they cause electrons in the atoms to move to a higher-energy state. When the electrons drop back to a lower energy state, they release a photon: light. This process creates the beautiful aurora, or northern lights.
Explanation:
UwU I know this because I'm subscribed to Jacksepticeye, Me Big Brain
Should music that Glorifies Violence Against Women be banned
Advocates for banning such music argue that it perpetuates harmful stereotypes, normalizes violence, and contributes to a culture of misogyny and gender-based violence.
The music that glorifies violence against women should be banned is a subjective and complex issue that involves considerations of freedom of expression, artistic freedom, societal values, and the potential impact on individuals and communities.
Banning such music is necessary to promote respect, equality, and the well-being of women.
It requires careful consideration of various perspectives and a broader conversation among stakeholders, including artists, activists, scholars, policymakers, and the public.
To learn more about violence against women, refer:
https://brainly.com/question/33879524
#SPJ4
You are a lawyer. The police have charged one of your clients with murder. However, she insists that she committed the crime in self-defense. Which principle of classical theory will form a strong foundation for your argument in the case?
A. People are rational and make choices that are beneficial to them.
B. Punishment deters people.
C. Punishment should be swift.
D. People have free will.
E. People commit crime because it is beyond their control.
50 points and brainlist
1. Follow the steps below to search for scholarships that fit your personal profile. (5 points)
Go to the College Board Scholarship Search site.
Click "Start." Then fill in your personal information and click "See Results."
Browse through the scholarships that the search returns.
List and briefly describe two scholarships that you might be interested in applying for. Make sure you include the following:
The name of the scholarship
The eligibility requirements
The application requirements
The amount of the award
A sentence or two explaining why you might (or might not) qualify
The two scholarships that I might be interested in applying for are:
Commonwealth scholarship. Fulbright-Nehru Doctoral Research Fellowships.What is Scholarship?A scholarship is known to be a kind financial aid that is said to be awarded to students that are interested in furthering their education.
Note that The two scholarships that I might be interested in applying for are Commonwealth scholarship and Fulbright-Nehru Doctoral Research Fellowships because they give full scholarship and also sponsor family members.
Learn more about scholarships from
https://brainly.com/question/599025
#SPJ1
The surface area of a 2 cm x 2 cm cube is 24 cm2. If the 2 cm x 2 cm cube is cut in half, what is the sum of the surface area for both halves and how would it affect the rate of a chemical reaction?
Answer:When the concentrations of the reactants are raised, the reaction proceeds more quickly. This is due to an increase in the number of molecules that have the minimum required energy. For gases, increasing pressure has the same effect as increasing concentration.
When solids and liquids react, increasing the surface area of the solid will increase the reaction rate. A decrease in particle size causes an increase in the solid’s total surface area.
Raising the reaction temperature by 10 °C can double or triple the reaction rate. This is due to an increase in the number of particles that have the minimum energy required. The reaction rate decreases with a decrease in temperature.
Catalysts can lower the activation energy and increase the reaction rate without being consumed in the reaction.
Differences in the inherent structures of reactants can lead to differences in reaction rates. Molecules joined by stronger bonds will have lower reaction rates than will molecules joined by weaker bonds, due to the increased amount of energy required to break the stronger bonds.
Explanation:
To show that the results from an experiment are valid, a scientist A. must claim that no errors were made during the experiment. B. must convince 20 other scientists to do the experiment. C. must repeat the experiment multiple times and get the same results. D. must show that the experiment produces different results each time.
Answer:
C. Must repeat the experiment multiple times and get the same results.
Explanation:
trust me :))
What is a goal of the mission of the James Webb Space Telescope?
to find evidence of life on Mars
to study how solar flares of our sun affect Earth
to find evidence of events in the history of the universe
to study how Venus and Earth diverged as planets
(33 points)
Answer:
to find evidence of events in the history of the universe
Explanation:
A goal of the mission of the James Webb Space Telescope is to find evidence of events in the history of the universe.
The correct answer to the given question is option C.
The James Webb Space Telescope has several objectives and goals, with the primary aim of its mission being to identify the events that led to the formation of the universe.
In addition, it aims to collect data on various galaxies, stars, and planets that will help scientists determine the evolution of these entities.The primary objective of the James Webb Space Telescope is to identify the early universe's formation by collecting data on the stars, galaxies, and planets.
It is also aimed at gathering data on various celestial objects such as exoplanets and black holes.The James Webb Space Telescope aims to collect data that will allow astronomers to determine the events that led to the formation of the universe.
It will collect data on distant galaxies, stars, and planets to provide insights into the evolution of these entities. The telescope will have advanced capabilities such as infrared vision that will allow it to collect data on some of the universe's earliest structures.
Additionally, the James Webb Space Telescope aims to collect data on exoplanets, which could provide insights into how life in the universe developed. The telescope's ability to identify the atmospheric composition of exoplanets will be crucial in determining their habitability.
Ultimately, the telescope's primary goal is to contribute to the advancement of our understanding of the universe.
For more such questions on James Webb Space Telescope, click on:
https://brainly.com/question/8962979
#SPJ8
An ability to talk easily to people might be associated with a career in which cluster?
A. Information sciences
B.Marketing, sales and service
C. Manufacturing
D. Agriculture, food and natural resources
Answer:
The answer is B
Explanation:
The photograph below shows a carved limestone head. The surface of this
limestone has changed over many years.
Which process made the surface of the limestone change over many years?
carving
polishing
melting
weathering
Name a substance in the air that made the surface of the limestone
change.
ASAP
Answer:
Weathering (I think)
Explanation:
don't know what else to add because you need a minimum of twenty words to answer